PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 482816
Common NameARALYDRAFT_482816
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 299aa    MW: 33246.8 Da    PI: 5.7273
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
482816genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.11.2e-092873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a + + ++   +W+++a++++ g+t  +++  ++ 
           482816 28 KWTAEENKKFENALAFYDKDtpdRWSKVAAMLP-GKTIGDVIKQYRE 73
                     8********************************.******9999986 PP

2Myb_DNA-binding48.61.9e-15142186347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
           482816 142 PWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 186
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-52373IPR009057Homeodomain-like
PROSITE profilePS512938.3192479IPR017884SANT domain
SMARTSM007173.7E-102577IPR001005SANT/Myb domain
SuperFamilySSF466891.31E-112781IPR009057Homeodomain-like
PfamPF002494.8E-82873IPR001005SANT/Myb domain
CDDcd001678.97E-82874No hitNo description
PROSITE profilePS5129421.845135191IPR017930Myb domain
SuperFamilySSF466891.66E-17137190IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-18138190IPR006447Myb domain, plants
SMARTSM007178.7E-14139189IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-13139186IPR009057Homeodomain-like
PfamPF002497.8E-13142186IPR001005SANT/Myb domain
CDDcd001672.84E-11142187No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MHRGIQVMSP ATYLETSNWL FQENRGTKWT AEENKKFENA LAFYDKDTPD RWSKVAAMLP  60
GKTIGDVIKQ YRELEEDVSD IEAGLIPIPG YVSDSFTLDW GGYDGAGGNN GFNMNGYYFS  120
AAGGKRGSAA RTAEHERKKG VPWTEEEHRQ FLMGLKKYGK GDWRNIARNF VTTRTPTQVA  180
SHAQKYFIRQ VNGGKDKRRS SIHDITTVNI PDSPDAAAAD NATANAPCSP PSIGGSQRET  240
SEWEGQTLYD ETTAAFYSQN AFSETLLGMS STPYMAKLQE QSFLNASQFE SYNAYLQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-172691873RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1181350.0AK118135.1 Arabidopsis thaliana At2g38090 mRNA for putative MYB family transcription factor, complete cds, clone: RAFL19-43-J04.
GenBankAY5195290.0AY519529.1 Arabidopsis thaliana MYB transcription factor (At2g38090) mRNA, complete cds.
GenBankBT0061220.0BT006122.1 Arabidopsis thaliana clone U50930 putative MYB family transcription factor (At2g38090) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002879727.10.0myb family transcription factor
SwissprotQ8S9H74e-95DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD7LKT00.0D7LKT0_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.4__1876__AT2G38090.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-180MYB family protein